CAL-EF-AFi : : A Server for Prediction and analysis of canonical EF-loop in Ca2+ binding EF-hand motifs

SVM Prediction For EF Loop Region based on Binary Pattern
The classifier calculates Binary features for the query sequence to predict the Canonical EF-hand loops in a sequence.

Please submit a protein sequence or sequences in FASTA format::
> example protein sequence of EhCabp1

MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQGQDL SDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL

OR please upload a protein sequence file:

Note : The server module is tested for identification of EF loop containing sequences (Limit : File size < 1mb). For proteome based scanning or scanning large files we strongly recommend to use the local version of Cal-EF-Affi available under the Downloads Section.